Lineage for d2o06b1 (2o06 B:15-300)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 704785Family c.66.1.17: Spermidine synthase [69557] (2 proteins)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 704790Protein Spermidine synthase [69558] (6 species)
    polyamine aminopropyltransferase
  7. 704799Species Human (Homo sapiens) [TaxId:9606] [142590] (4 PDB entries)
  8. 704803Domain d2o06b1: 2o06 B:15-300 [138861]
    automatically matched to 2O05 A:15-300
    complexed with mg, mta, put

Details for d2o06b1

PDB Entry: 2o06 (more details), 2 Å

PDB Description: Human spermidine synthase
PDB Compounds: (B:) spermidine synthase

SCOP Domain Sequences for d2o06b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o06b1 c.66.1.17 (B:15-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]}
airegwfretcslwpgqalslqveqllhhrrsryqdilvfrsktygnvlvldgviqcter
defsyqemianlplcshpnprkvliigggdggvlrevvkhpsvesvvqceidedviqvsk
kflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpmgpaeslfkesyyqlmk
talkedgvlccqgecqwlhldlikemrqfcqslfpvvayayctiptypsgqigfmlcskn
pstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkalnd

SCOP Domain Coordinates for d2o06b1:

Click to download the PDB-style file with coordinates for d2o06b1.
(The format of our PDB-style files is described here.)

Timeline for d2o06b1: