Lineage for d2jhua2 (2jhu A:67-202)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765599Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 2765633Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)
  7. 2765638Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries)
  8. 2765645Domain d2jhua2: 2jhu A:67-202 [138323]
    Other proteins in same PDB: d2jhua3, d2jhub3
    automated match to d1kmta_
    complexed with so4; mutant

Details for d2jhua2

PDB Entry: 2jhu (more details), 1.65 Å

PDB Description: crystal structure of rhogdi e154a,e155a mutant
PDB Compounds: (A:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d2jhua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jhua2 b.1.18.8 (A:67-202) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdddk
tdhlswewnltikkdw

SCOPe Domain Coordinates for d2jhua2:

Click to download the PDB-style file with coordinates for d2jhua2.
(The format of our PDB-style files is described here.)

Timeline for d2jhua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jhua3