Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries) |
Domain d2jhub2: 2jhu B:67-202 [138324] Other proteins in same PDB: d2jhua3, d2jhub3 automated match to d1kmta_ complexed with so4; mutant |
PDB Entry: 2jhu (more details), 1.65 Å
SCOPe Domain Sequences for d2jhub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jhub2 b.1.18.8 (B:67-202) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]} vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm kyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdddk tdhlswewnltikkdw
Timeline for d2jhub2: