PDB entry 2jhu

View 2jhu on RCSB PDB site
Description: crystal structure of rhogdi e154a,e155a mutant
Class: inhibitor
Keywords: surface entropy reduction, inhibitor, gtpase activation, crystal engineering
Deposited on 2007-02-23, released 2007-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.209
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rho GDP-dissociation inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JHU (0-1)
      • engineered mutation (89-90)
    • Uniprot P52565 (2-137)
    Domains in SCOPe 2.08: d2jhua2, d2jhua3
  • Chain 'B':
    Compound: rho GDP-dissociation inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JHU (0-1)
      • engineered mutation (89-90)
    • Uniprot P52565 (2-137)
    Domains in SCOPe 2.08: d2jhub2, d2jhub3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jhuA (A:)
    amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
    gmkyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdd
    dktdhlswewnltikkdw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jhuB (B:)
    amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
    gmkyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdd
    dktdhlswewnltikkdw