Lineage for d2jhua1 (2jhu A:65-202)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 659008Family b.1.18.8: RhoGDI-like [81288] (2 proteins)
  6. 659014Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)
  7. 659023Species Human (Homo sapiens) [TaxId:9606] [49242] (11 PDB entries)
  8. 659026Domain d2jhua1: 2jhu A:65-202 [138323]
    automatically matched to d1kmta_
    complexed with so4; mutant

Details for d2jhua1

PDB Entry: 2jhu (more details), 1.65 Å

PDB Description: crystal structure of rhogdi e154a,e155a mutant
PDB Compounds: (A:) rho GDP-dissociation inhibitor 1

SCOP Domain Sequences for d2jhua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jhua1 b.1.18.8 (A:65-202) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw

SCOP Domain Coordinates for d2jhua1:

Click to download the PDB-style file with coordinates for d2jhua1.
(The format of our PDB-style files is described here.)

Timeline for d2jhua1: