| Class b: All beta proteins [48724] (174 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
| Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
| Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (31 PDB entries) Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601 |
| Domain d2jfca2: 2jfc A:160-336 [138292] automatically matched to d1gs6x2 complexed with cl, cu; mutant |
PDB Entry: 2jfc (more details), 2.4 Å
SCOPe Domain Sequences for d2jfca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jfca2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr
Timeline for d2jfca2: