Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein automated matches [226877] (4 species) not a true protein |
Species Achromobacter xylosoxidans [TaxId:85698] [225099] (11 PDB entries) |
Domain d2jfca2: 2jfc A:160-336 [138292] automated match to d1oe1a2 complexed with cl, cu; mutant |
PDB Entry: 2jfc (more details), 2.4 Å
SCOPe Domain Sequences for d2jfca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jfca2 b.6.1.3 (A:160-336) automated matches {Achromobacter xylosoxidans [TaxId: 85698]} qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr
Timeline for d2jfca2: