Lineage for d1gs6x2 (1gs6 X:160-336)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 940170Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 940171Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 940701Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 940824Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 941045Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (31 PDB entries)
    Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601
  8. 941121Domain d1gs6x2: 1gs6 X:160-336 [65530]
    complexed with cu, mg; mutant

Details for d1gs6x2

PDB Entry: 1gs6 (more details), 2.2 Å

PDB Description: crystal structure of m144a mutant of alcaligenes xylosoxidans nitrite reductase
PDB Compounds: (X:) nitrite reductase

SCOPe Domain Sequences for d1gs6x2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gs6x2 b.6.1.3 (X:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr

SCOPe Domain Coordinates for d1gs6x2:

Click to download the PDB-style file with coordinates for d1gs6x2.
(The format of our PDB-style files is described here.)

Timeline for d1gs6x2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gs6x1