Lineage for d2jazc_ (2jaz C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487541Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) (S)
    automatically mapped to Pfam PF01320
  5. 1487542Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)
  6. 1487543Protein ImmE7 protein (Im7) [47347] (1 species)
  7. 1487544Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)
  8. 1487557Domain d2jazc_: 2jaz C: [138245]
    Other proteins in same PDB: d2jazb1, d2jazd_
    automated match to d1mz8a_
    protein/DNA complex; complexed with po4, zn; mutant

Details for d2jazc_

PDB Entry: 2jaz (more details), 2.03 Å

PDB Description: crystal structure of the mutant n560d of the nuclease domain of cole7 in complex with im7
PDB Compounds: (C:) colicin e7 immunity protein

SCOPe Domain Sequences for d2jazc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jazc_ a.28.2.1 (C:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
elknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnr
ddspegivkeikewraangkpgfkqg

SCOPe Domain Coordinates for d2jazc_:

Click to download the PDB-style file with coordinates for d2jazc_.
(The format of our PDB-style files is described here.)

Timeline for d2jazc_: