Class a: All alpha proteins [46456] (285 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) automatically mapped to Pfam PF01320 |
Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins) |
Protein ImmE7 protein (Im7) [47347] (1 species) |
Species Escherichia coli [TaxId:562] [47348] (10 PDB entries) |
Domain d2jazc_: 2jaz C: [138245] Other proteins in same PDB: d2jazb1, d2jazd_ automated match to d1mz8a_ protein/DNA complex; complexed with po4, zn; mutant |
PDB Entry: 2jaz (more details), 2.03 Å
SCOPe Domain Sequences for d2jazc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jazc_ a.28.2.1 (C:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]} elknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnr ddspegivkeikewraangkpgfkqg
Timeline for d2jazc_: