SCOPe 2.04: Domain d2jazd_: 2jaz D:

Lineage for d2jazd_ (2jaz D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein DNase domain of colicin E7 [54062] (1 species)

7. Species Escherichia coli [TaxId:562] [54063] (10 PDB entries)

8. Domain d2jazd_: 2jaz D: [145680]
   Other proteins in same PDB: d2jaza_, d2jazc_
   automated match to d1mz8b_
   protein/DNA complex; complexed with po4, zn; mutant

Details for d2jazd_

PDB Entry: 2jaz, 2.03 Å

PDB Description: crystal structure of the mutant n560d of the nuclease domain of cole7 in complex with im7

PDB Compounds: (D:) colicin e7

SCOPe Domain Sequences for d2jazd_:

Sequence, based on SEQRES records:

>d2jazd_ d.4.1.1 (D:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
gkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpels
kqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmddisvvtpkrhi
dihrgk

Sequence, based on observed residues (ATOM records):

>d2jazd_ d.4.1.1 (D:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
gkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpels
kqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekvydmddisvvtpkrhidihrgk

Timeline for d2jazd_:

• d2jazd_ first appeared in SCOP 1.75, called d2jazd1
  
• d2jazd_ appears in SCOPe 2.03
  
• d2jazd_ appears in SCOPe 2.05
  
• d2jazd_ appears in the current release, SCOPe 2.08