SCOPe 2.05: Domain d2jazc_: 2jaz C:

Lineage for d2jazc_ (2jaz C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families)
   automatically mapped to Pfam PF01320

5. Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)

6. Protein ImmE7 protein (Im7) [47347] (1 species)

7. Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)

8. Domain d2jazc_: 2jaz C: [138245]
   Other proteins in same PDB: d2jazb1, d2jazd_
   automated match to d1mz8a_
   protein/DNA complex; complexed with po4, zn; mutant

Details for d2jazc_

PDB Entry: 2jaz, 2.03 Å

PDB Description: crystal structure of the mutant n560d of the nuclease domain of cole7 in complex with im7

PDB Compounds: (C:) colicin e7 immunity protein

SCOPe Domain Sequences for d2jazc_:

Sequence; same for both SEQRES and ATOM records:

>d2jazc_ a.28.2.1 (C:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
elknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnr
ddspegivkeikewraangkpgfkqg

Timeline for d2jazc_:

• d2jazc_ first appeared in SCOP 1.73, called d2jazc1
  
• d2jazc_ appears in SCOPe 2.04
  
• d2jazc_ appears in SCOPe 2.06
  
• d2jazc_ appears in the current release, SCOPe 2.08