SCOPe 2.08: Domain d2ja8e1: 2ja8 E:2-143

Lineage for d2ja8e1 (2ja8 E:2-143)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)

6. Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (27 PDB entries)
   Uniprot P20434; part of multichain biological unit

8. Domain d2ja8e1: 2ja8 E:2-143 [138227]
   Other proteins in same PDB: d2ja8a1, d2ja8b1, d2ja8c1, d2ja8c2, d2ja8d1, d2ja8e2, d2ja8f1, d2ja8g1, d2ja8g2, d2ja8h1, d2ja8i1, d2ja8i2, d2ja8j1, d2ja8k1, d2ja8l1
   automatically matched to d1i3qe1
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja8e1

PDB Entry: 2ja8, 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex d

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2ja8e1:

Sequence; same for both SEQRES and ATOM records:

>d2ja8e1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn

Timeline for d2ja8e1:

• d2ja8e1 first appeared in SCOP 1.73
  
• d2ja8e1 appears in SCOPe 2.07