Lineage for d2ja8b1 (2ja8 B:20-1224)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574252Family e.29.1.1: RNA-polymerase beta [64485] (4 proteins)
  6. 2574253Protein RBP2 [64491] (2 species)
  7. 2574254Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64492] (27 PDB entries)
    Uniprot P08518; part of multichain biological unit
  8. 2574276Domain d2ja8b1: 2ja8 B:20-1224 [138223]
    Other proteins in same PDB: d2ja8a1, d2ja8c1, d2ja8c2, d2ja8d1, d2ja8e1, d2ja8e2, d2ja8f1, d2ja8g1, d2ja8g2, d2ja8h1, d2ja8i1, d2ja8i2, d2ja8j1, d2ja8k1, d2ja8l1
    automatically matched to d1i50b_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja8b1

PDB Entry: 2ja8 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex d
PDB Compounds: (B:) DNA-directed RNA polymerase II 140 kDa polypeptide

SCOPe Domain Sequences for d2ja8b1:

Sequence, based on SEQRES records: (download)

>d2ja8b1 e.29.1.1 (B:20-1224) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqhtt
esdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyea
idvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpfdm
ggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvkly
gregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpcve
dgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkafflg
yminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtveea
hdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtn
tpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitfls
ewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdi
rekelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedveey
twssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhattft
hceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyyp
qkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffrsy
mdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttpis
pdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqigdk
fasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaalsg
negdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrhmv
ddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasdafr
vhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprlytd
rsrdf

Sequence, based on observed residues (ATOM records): (download)

>d2ja8b1 e.29.1.1 (B:20-1224) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstliisfgkiyvt
kpmvnesdgvthalypqearlrnltyssglfvdvkkvfigrlpimlrskncylseatesd
lyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgs
rfistlqvklygregssartikatlpyikqdipiviifralgiipdgeilehicydvndw
qmlemlkpcvedgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqle
gfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdi
frymqrtvelainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlr
rtntpikprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgm
epledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdireke
lkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglvey
idaeeeesiliamqpedlepaeadvdpakrirvshhattfthceihpsmilgvaasiipf
pdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelp
agqnaivaiacysgynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekpq
rtntlrmkhgtydkldddgliapgvrvsgedviigkttpisskrdastplrstengivdq
vlvttnqdglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdli
inphaipsrmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfev
mynghtgkklmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrfg
emerdcmiahgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkidi
yqihipyaakllfqelmamnitprlytdrsrdf

SCOPe Domain Coordinates for d2ja8b1:

Click to download the PDB-style file with coordinates for d2ja8b1.
(The format of our PDB-style files is described here.)

Timeline for d2ja8b1: