Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) automatically mapped to Pfam PF01000 |
Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins) |
Protein RPB3 [64462] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries) Uniprot P16370; part of multichain biological unit |
Domain d2ja8c2: 2ja8 C:42-172 [138225] Other proteins in same PDB: d2ja8a1, d2ja8b1, d2ja8c1, d2ja8d1, d2ja8e1, d2ja8e2, d2ja8f1, d2ja8g1, d2ja8g2, d2ja8h1, d2ja8i1, d2ja8i2, d2ja8j1, d2ja8k1, d2ja8l1 automatically matched to d1i3qc2 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2ja8 (more details), 3.8 Å
SCOPe Domain Sequences for d2ja8c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ja8c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk giakehakwgp
Timeline for d2ja8c2: