Lineage for d1i3qe1 (1i3q E:1-143)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882964Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 2882965Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)
  6. 2882966Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species)
  7. 2882967Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (27 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 2882971Domain d1i3qe1: 1i3q E:1-143 [61611]
    Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe2, d1i3qf_, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qj_, d1i3qk_, d1i3ql_
    protein/RNA complex; complexed with mg, zn

Details for d1i3qe1

PDB Entry: 1i3q (more details), 3.1 Å

PDB Description: rna polymerase ii crystal form i at 3.1 a resolution
PDB Compounds: (E:) DNA-directed RNA polymerase II 27kd polypeptide

SCOPe Domain Sequences for d1i3qe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3qe1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
mklvpsippatietfneaalvvn

SCOPe Domain Coordinates for d1i3qe1:

Click to download the PDB-style file with coordinates for d1i3qe1.
(The format of our PDB-style files is described here.)

Timeline for d1i3qe1: