Lineage for d1i3qa_ (1i3q A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574346Family e.29.1.2: RNA-polymerase beta-prime [64490] (4 proteins)
  6. 2574347Protein RBP1 [64486] (2 species)
  7. 2574348Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64487] (24 PDB entries)
    Uniprot P04050; part of multichain biological unit
  8. 2574352Domain d1i3qa_: 1i3q A: [61607]
    Other proteins in same PDB: d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qf_, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qj_, d1i3qk_, d1i3ql_
    protein/RNA complex; complexed with mg, zn

Details for d1i3qa_

PDB Entry: 1i3q (more details), 3.1 Å

PDB Description: rna polymerase ii crystal form i at 3.1 a resolution
PDB Compounds: (A:) DNA-directed RNA polymerase II largest subunit

SCOPe Domain Sequences for d1i3qa_:

Sequence, based on SEQRES records: (download)

>d1i3qa_ e.29.1.2 (A:) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglkl
vgswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpv
ppppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhva
tymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnlel
dqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskra
gdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynad
fdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfi
eldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspk
dngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhng
fstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrf
lneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvd
rtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrl
vkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdl
lntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnir
riiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccl
lrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtl
ntfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaieht
tlksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraa
mndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlk
kientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpg
idptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqggl
tsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgaf
dvmi

Sequence, based on observed residues (ATOM records): (download)

>d1i3qa_ e.29.1.2 (A:) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglkl
vgswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpv
ppppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhva
tymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnlel
dqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskra
gdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynad
fdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfi
eldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspk
dngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhng
fstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrf
lneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvd
rtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrl
vkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdl
lntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnir
riiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccl
lrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtl
kkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaiehttlksvtiase
iyydpdprstvipedeeiiqlhfslqqspwllrleldraamndkdltmgqvgerikqtfk
ndlfviwsedndekliircrvvaeedhmlkkientmlenitlrgveniervvmmkydrkv
psptgeyvkepewvletdgvnlsevmtvpgidptriytnsfidimevlgieagraalyke
vynviasdgsyvnyrhmallvdvmttqggltsvtrhgfnrsntgalmrcsfeetveilfe
agasaelddcrgvsenvilgqmapigtgafdvmi

SCOPe Domain Coordinates for d1i3qa_:

Click to download the PDB-style file with coordinates for d1i3qa_.
(The format of our PDB-style files is described here.)

Timeline for d1i3qa_: