SCOP 1.73: Domain d2j59b1: 2j59 B:16-180

Lineage for d2j59b1 (2j59 B:16-180)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (14 species)

7. Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (9 PDB entries)

8. Domain d2j59b1: 2j59 B:16-180 [138030]
   automatically matched to d1o3ya_
   complexed with dio, edo, gtp, mg, so4; mutant

Details for d2j59b1

PDB Entry: 2j59, 2.1 Å

PDB Description: crystal structure of the arf1:arhgap21-arfbd complex

PDB Compounds: (B:) ADP-ribosylation factor 1

SCOP Domain Sequences for d2j59b1:

Sequence; same for both SEQRES and ATOM records:

>d2j59b1 c.37.1.8 (B:16-180) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq

Timeline for d2j59b1:

• d2j59b1 is new in SCOP 1.73
  
• d2j59b1 appears in SCOP 1.75
  
• d2j59b1 appears in the current release, SCOPe 2.08, called d2j59b2