Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein ADP-ribosylation factor [52614] (14 species) |
Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (9 PDB entries) |
Domain d2j59c1: 2j59 C:16-180 [138031] automatically matched to d1o3ya_ complexed with dio, edo, gtp, mg, so4; mutant |
PDB Entry: 2j59 (more details), 2.1 Å
SCOP Domain Sequences for d2j59c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j59c1 c.37.1.8 (C:16-180) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq
Timeline for d2j59c1: