Lineage for d1o3ya_ (1o3y A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 695635Protein ADP-ribosylation factor [52614] (14 species)
  7. 695643Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (9 PDB entries)
  8. 695645Domain d1o3ya_: 1o3y A: [86618]

Details for d1o3ya_

PDB Entry: 1o3y (more details), 1.5 Å

PDB Description: crystal structure of mouse arf1 (delta17-q71l), gtp form
PDB Compounds: (A:) ADP-ribosylation factor 1

SCOP Domain Sequences for d1o3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o3ya_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk

SCOP Domain Coordinates for d1o3ya_:

Click to download the PDB-style file with coordinates for d1o3ya_.
(The format of our PDB-style files is described here.)

Timeline for d1o3ya_: