SCOPe 2.08: Domain d2j0te_: 2j0t E:

Lineage for d2j0te_ (2j0t E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.3: TIMP-like [50242] (4 families)

5. Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
   contains an irregular alpha+beta subdomain in the C-terminal extension
   automatically mapped to Pfam PF00965

6. Protein TIMP-1 [50244] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50245] (8 PDB entries)

8. Domain d2j0te_: 2j0t E: [137921]
   Other proteins in same PDB: d2j0ta_, d2j0tb_, d2j0tc_
   automated match to d1d2ba_
   complexed with ca, zn

Details for d2j0te_

PDB Entry: 2j0t, 2.54 Å

PDB Description: crystal structure of the catalytic domain of mmp-1 in complex with the inhibitory domain of timp-1

PDB Compounds: (E:) Metalloproteinase inhibitor 1

SCOPe Domain Sequences for d2j0te_:

Sequence; same for both SEQRES and ATOM records:

>d2j0te_ b.40.3.1 (E:) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
tvgc

Timeline for d2j0te_:

• d2j0te_ first appeared in SCOP 1.73, called d2j0te1
  
• d2j0te_ appears in SCOPe 2.07