Lineage for d2j0te1 (2j0t E:1-124)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667979Superfamily b.40.3: TIMP-like [50242] (3 families) (S)
  5. 667980Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
    contains an irregular alpha+beta subdomain in the C-terminal extension
  6. 667981Protein TIMP-1 [50244] (1 species)
  7. 667982Species Human (Homo sapiens) [TaxId:9606] [50245] (4 PDB entries)
  8. 667984Domain d2j0te1: 2j0t E:1-124 [137921]
    Other proteins in same PDB: d2j0ta1, d2j0tb1, d2j0tc1
    automatically matched to d1d2ba_
    complexed with ca, zn

Details for d2j0te1

PDB Entry: 2j0t (more details), 2.54 Å

PDB Description: crystal structure of the catalytic domain of mmp-1 in complex with the inhibitory domain of timp-1
PDB Compounds: (E:) Metalloproteinase inhibitor 1

SCOP Domain Sequences for d2j0te1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0te1 b.40.3.1 (E:1-124) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
tvgc

SCOP Domain Coordinates for d2j0te1:

Click to download the PDB-style file with coordinates for d2j0te1.
(The format of our PDB-style files is described here.)

Timeline for d2j0te1: