SCOPe 2.08: Domain d2j0ta_: 2j0t A:

Lineage for d2j0ta_ (2j0t A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Fibroblast collagenase (MMP-1) [55529] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55530] (13 PDB entries)
   Uniprot P03956 32-466

8. Domain d2j0ta_: 2j0t A: [137917]
   Other proteins in same PDB: d2j0td_, d2j0te_, d2j0tf_
   automated match to d1ayk__
   complexed with ca, zn

Details for d2j0ta_

PDB Entry: 2j0t, 2.54 Å

PDB Description: crystal structure of the catalytic domain of mmp-1 in complex with the inhibitory domain of timp-1

PDB Compounds: (A:) interstitial collagenase

SCOPe Domain Sequences for d2j0ta_:

Sequence; same for both SEQRES and ATOM records:

>d2j0ta_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
gnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfv
rgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghsl
glshstdigalmypsytfsgdvqlaqddidgiqaiygrsqn

Timeline for d2j0ta_:

• d2j0ta_ first appeared in SCOP 1.73, called d2j0ta1
  
• d2j0ta_ appears in SCOPe 2.07