Lineage for d2j0ta_ (2j0t A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964341Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 2964342Species Human (Homo sapiens) [TaxId:9606] [55530] (13 PDB entries)
    Uniprot P03956 32-466
  8. 2964351Domain d2j0ta_: 2j0t A: [137917]
    Other proteins in same PDB: d2j0td_, d2j0te_, d2j0tf_
    automated match to d1ayk__
    complexed with ca, zn

Details for d2j0ta_

PDB Entry: 2j0t (more details), 2.54 Å

PDB Description: crystal structure of the catalytic domain of mmp-1 in complex with the inhibitory domain of timp-1
PDB Compounds: (A:) interstitial collagenase

SCOPe Domain Sequences for d2j0ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0ta_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
gnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfv
rgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghsl
glshstdigalmypsytfsgdvqlaqddidgiqaiygrsqn

SCOPe Domain Coordinates for d2j0ta_:

Click to download the PDB-style file with coordinates for d2j0ta_.
(The format of our PDB-style files is described here.)

Timeline for d2j0ta_: