Lineage for d2j0tf_ (2j0t F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789220Superfamily b.40.3: TIMP-like [50242] (4 families) (S)
  5. 2789221Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
    contains an irregular alpha+beta subdomain in the C-terminal extension
    automatically mapped to Pfam PF00965
  6. 2789222Protein TIMP-1 [50244] (1 species)
  7. 2789223Species Human (Homo sapiens) [TaxId:9606] [50245] (8 PDB entries)
  8. 2789229Domain d2j0tf_: 2j0t F: [137922]
    Other proteins in same PDB: d2j0ta_, d2j0tb_, d2j0tc_
    automated match to d1d2ba_
    complexed with ca, zn

Details for d2j0tf_

PDB Entry: 2j0t (more details), 2.54 Å

PDB Description: crystal structure of the catalytic domain of mmp-1 in complex with the inhibitory domain of timp-1
PDB Compounds: (F:) Metalloproteinase inhibitor 1

SCOPe Domain Sequences for d2j0tf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0tf_ b.40.3.1 (F:) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
tvgc

SCOPe Domain Coordinates for d2j0tf_:

Click to download the PDB-style file with coordinates for d2j0tf_.
(The format of our PDB-style files is described here.)

Timeline for d2j0tf_: