![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
![]() | Protein Fibroblast collagenase (MMP-1) [55529] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55530] (13 PDB entries) Uniprot P03956 32-466 |
![]() | Domain d2j0tb_: 2j0t B: [137918] Other proteins in same PDB: d2j0td_, d2j0te_, d2j0tf_ automated match to d1ayk__ complexed with ca, zn |
PDB Entry: 2j0t (more details), 2.54 Å
SCOPe Domain Sequences for d2j0tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0tb_ d.92.1.11 (B:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} gnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfv rgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghsl glshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnp
Timeline for d2j0tb_: