Lineage for d2j09a1 (2j09 A:172-420)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334339Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 2334340Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. 2334341Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 proteins)
  6. 2334342Protein C-terminal domain of DNA photolyase [48175] (3 species)
    N-terminal domain is alpha/beta and binds a light-harvesting cofactor
  7. 2334357Species Thermus thermophilus [TaxId:274] [69083] (5 PDB entries)
  8. 2334361Domain d2j09a1: 2j09 A:172-420 [137895]
    Other proteins in same PDB: d2j09a2
    automated match to d1iqra1
    complexed with cl, fad, fmn, po4

Details for d2j09a1

PDB Entry: 2j09 (more details), 2 Å

PDB Description: thermus dna photolyase with fmn antenna chromophore
PDB Compounds: (A:) deoxyribodipyrimidine photo-lyase

SCOPe Domain Sequences for d2j09a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j09a1 a.99.1.1 (A:172-420) C-terminal domain of DNA photolyase {Thermus thermophilus [TaxId: 274]}
lplpepgeeaalaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweae
rrggegarkwvaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktg
vplvdaamrelhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgw
qwagglgvdaapyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrryl
rlardlarg

SCOPe Domain Coordinates for d2j09a1:

Click to download the PDB-style file with coordinates for d2j09a1.
(The format of our PDB-style files is described here.)

Timeline for d2j09a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j09a2