Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) automatically mapped to Pfam PF00875 |
Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (3 proteins) |
Protein DNA photolyase [52427] (3 species) binds a light-harvesting cofactor |
Species Thermus thermophilus [TaxId:274] [69460] (5 PDB entries) |
Domain d2j09a2: 2j09 A:2-171 [137896] Other proteins in same PDB: d2j09a1 automated match to d1iqra2 complexed with cl, fad, fmn, po4 |
PDB Entry: 2j09 (more details), 2 Å
SCOPe Domain Sequences for d2j09a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j09a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} gpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreay rarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpa phllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpg
Timeline for d2j09a2: