Lineage for d2j09a1 (2j09 A:172-405)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645559Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 645560Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (1 family) (S)
  5. 645561Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (2 proteins)
  6. 645562Protein C-terminal domain of DNA photolyase [48175] (3 species)
    N-terminal domain is alpha/beta and binds a light-harvesting cofactor
  7. 645577Species Thermus thermophilus [TaxId:274] [69083] (5 PDB entries)
  8. 645579Domain d2j09a1: 2j09 A:172-405 [137895]
    Other proteins in same PDB: d2j09a2
    automatically matched to d1iqra1
    complexed with cl, fad, fmn, po4

Details for d2j09a1

PDB Entry: 2j09 (more details), 2 Å

PDB Description: thermus dna photolyase with fmn antenna chromophore
PDB Compounds: (A:) deoxyribodipyrimidine photo-lyase

SCOP Domain Sequences for d2j09a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j09a1 a.99.1.1 (A:172-405) C-terminal domain of DNA photolyase {Thermus thermophilus [TaxId: 274]}
lplpepgeeaalaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweae
rrggegarkwvaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktg
vplvdaamrelhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgw
qwagglgvdaapyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdlee

SCOP Domain Coordinates for d2j09a1:

Click to download the PDB-style file with coordinates for d2j09a1.
(The format of our PDB-style files is described here.)

Timeline for d2j09a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j09a2