SCOPe 2.08: Domain d2j03i1: 2j03 I:56-146

Lineage for d2j03i1 (2j03 I:56-146)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
   alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta

4. Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family)
   automatically mapped to Pfam PF03948

5. Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)

6. Protein Ribosomal protein L9 C-domain [55655] (3 species)

7. Species Thermus thermophilus [TaxId:274] [143635] (9 PDB entries)
   Uniprot Q5SLQ1 55-146

8. Domain d2j03i1: 2j03 I:56-146 [137888]
   Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
   protein/RNA complex
   protein/RNA complex

Details for d2j03i1

PDB Entry: 2j03, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.

PDB Compounds: (I:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2j03i1:

Sequence; same for both SEQRES and ATOM records:

>d2j03i1 d.99.1.1 (I:56-146) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
krlaerkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla
lekpikelgeyvltykphpevpiqlkvsvva

Timeline for d2j03i1:

• d2j03i1 first appeared in SCOP 1.73
  
• d2j03i1 appears in SCOPe 2.07