Lineage for d2j03r1 (2j03 R:14-118)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005595Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 3005596Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
    automatically mapped to Pfam PF01196
  5. 3005597Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 3005598Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 3005636Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries)
  8. 3005646Domain d2j03r1: 2j03 R:14-118 [145601]
    Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    protein/RNA complex
    protein/RNA complex

Details for d2j03r1

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (R:) 50S ribosomal protein L17

SCOPe Domain Sequences for d2j03r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j03r1 d.188.1.1 (R:14-118) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

SCOPe Domain Coordinates for d2j03r1:

Click to download the PDB-style file with coordinates for d2j03r1.
(The format of our PDB-style files is described here.)

Timeline for d2j03r1: