PDB entry 2j03

View 2j03 on RCSB PDB site
Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
Class: ribosome
Keywords: ribosome, tRNA, paromomycin, mRNA, translation
Deposited on 2006-07-31, released 2006-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2715
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 50S ribosomal protein L27
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J03 (0-0)
    • Uniprot P60493 (1-84)
  • Chain '1':
    Compound: 50S ribosomal protein L28
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j0311
  • Chain '2':
    Compound: 50S ribosomal protein L29
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j0321
  • Chain '3':
    Compound: 50S ribosomal protein L30
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J03 (0-0)
    • Uniprot Q5SHQ6 (1-59)
    Domains in SCOPe 2.06: d2j0331
  • Chain '4':
    Compound: 50S ribosomal protein L31
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j0341
  • Chain '5':
    Compound: 50S ribosomal protein L32
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J03
    • Uniprot P80339 (1-59)
    Domains in SCOPe 2.06: d2j0351
  • Chain '6':
    Compound: 50S ribosomal protein L33
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j0361
  • Chain '7':
    Compound: 50S ribosomal protein L34
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j0371
  • Chain '8':
    Compound: 50S ribosomal protein L35
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J03
    • Uniprot P80341 (1-64)
    Domains in SCOPe 2.06: d2j0381
  • Chain '9':
    Compound: 50S ribosomal protein L36
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: 23S ribosomal RNA
    Species: Thermus thermophilus [TaxId:300852]
  • Chain 'B':
    Compound: 5S ribosomal RNA
    Species: Thermus thermophilus [TaxId:300852]
  • Chain 'C':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03c1
  • Chain 'D':
    Compound: 50S ribosomal protein L2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J03
    • Uniprot P60405 (1-End)
    Domains in SCOPe 2.06: d2j03d1, d2j03d2
  • Chain 'E':
    Compound: 50S ribosomal protein L3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03e1
  • Chain 'F':
    Compound: 50S ribosomal protein L4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03f1
  • Chain 'G':
    Compound: 50S ribosomal protein L5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J03
    • Uniprot Q5SHQ0 (1-181)
    Domains in SCOPe 2.06: d2j03g1
  • Chain 'H':
    Compound: 50S ribosomal protein L6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03h1, d2j03h2
  • Chain 'I':
    Compound: 50S ribosomal protein L9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03i1, d2j03i2
  • Chain 'J':
    Compound: 50s ribosomal protein l10
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 50s ribosomal protein l7
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 50s ribosomal protein l7
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 50S ribosomal protein L13
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03n1
  • Chain 'O':
    Compound: 50S ribosomal protein L14
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03o1
  • Chain 'P':
    Compound: 50S ribosomal protein L15
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03p1
  • Chain 'Q':
    Compound: 50S ribosomal protein L16
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03q1
  • Chain 'R':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03r1
  • Chain 'S':
    Compound: 50S ribosomal protein L18
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03s1
  • Chain 'T':
    Compound: 50S ribosomal protein L19
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03t1
  • Chain 'U':
    Compound: 50S ribosomal protein L20
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J03
    • Uniprot P60491 (1-117)
    Domains in SCOPe 2.06: d2j03u1
  • Chain 'V':
    Compound: 50S ribosomal protein L21
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03v1
  • Chain 'W':
    Compound: 50S ribosomal protein L22
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03w1
  • Chain 'X':
    Compound: 50S ribosomal protein L23
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03x1
  • Chain 'Y':
    Compound: 50S ribosomal protein L24
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03y1
  • Chain 'Z':
    Compound: 50S ribosomal protein L25
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j03z1

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >2j031 (1:)
    mskvceisgkrpivansiqrrgkakreggvgkkttgiskrrqypnlqkvrvrvagqeitf
    rvaashipkvyelverakglkleglspkeikkellkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j031 (1:)
    sgkrpivansiqrrgkakreggvgkkttgiskrrqypnlqkvrvrvagqeitfrvaashi
    pkvyelverakglkleglspkeikkellk
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >2j032 (2:)
    mklsevrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarl
    ltvlnekrrqna
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j032 (2:)
    earklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarllt
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j033 (3:)
    mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >2j034 (4:)
    mkegihpklvpariicgcgnvietystkpeiyvevcskchpfytgqqrfvdtegrverfq
    rrygdsyrkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j034 (4:)
    mkegihpklvpariicgcgnvietystkpeiyvevcskchpfytgqqrfv
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >2j035 (5:)
    makhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j035 (5:)
    akhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >2j036 (6:)
    masevriklllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j036 (6:)
    lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevk
    

  • Chain '7':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j037 (7:)
    mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr
    

  • Chain '8':
    Sequence, based on SEQRES records: (download)
    >2j038 (8:)
    mpkmkthkgakkrvkitasgkvvamktgkrhlnwqksgkeirqkgrkfvlakpeaerikl
    llpye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j038 (8:)
    pkmkthkgakkrvkitasgkvvamktgkrhlnwqksgkeirqkgrkfvlakpeaerikll
    lpye
    

  • Chain '9':
    No sequence available.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j03C (C:)
    mpkhgkryrallekvdpnkvytideaarlvkelatakfdetvevhaklgidprrsdqnvr
    gtvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdv
    mgavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkas
    fppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03C (C:)
    kvytideaartakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlaiakgeki
    keaeeagadyvggeeiiqkildgwmdfvmgavgsklgrilgprglnpkagtvgfnigeii
    reikagriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvy
    vtttmgpsvri
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j03D (D:)
    mavkkfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkr
    lyriidfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvag
    pdapiqvgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsg
    elrkvhgecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegra
    prgrppaspwgwqtkglktrkrrkpssrfiiarrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03D (D:)
    avkkfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkrl
    yriidfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvagp
    dapiqvgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsge
    lrkvhgecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegrap
    rgrppaspwgwqtkglktrkrrkpssrfiiar
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2j03E (E:)
    mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn
    rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw
    nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen
    lllvkgavpgpngglvivretkkaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03E (E:)
    mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn
    rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw
    nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen
    lllvkgavpgpngglvivretkkaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2j03F (F:)
    mkevavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevays
    grkiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadrare
    gklllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeg
    lnvydivrterlvmdldawevfqnriggea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03F (F:)
    mkevavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevays
    grkiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadrare
    gklllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeg
    lnvydivrterlvmdldawevfqnrigg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2j03G (G:)
    mpldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqel
    alitgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrgl
    npnsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpf
    rk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03G (G:)
    pldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqela
    litgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrgln
    pnsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfr
    k
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2j03H (H:)
    msrigrlpipvpkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderr
    hkslhgltrtlianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppeg
    itfevpeptrvrvsgidkqkvgqvaanirairkpsayhekgiyyagepvrlkpgkagakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03H (H:)
    pkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderrhkslhgltrtl
    ianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrv
    rvsgidkqkvgqvaanirairkpsayhekgiyyagepvrl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2j03I (I:)
    mkvilleplenlgdvgqvvdvkpgyarnyllprglavlatesnlkaleariraqakrlae
    rkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrlalekpi
    kelgeyvltykphpevpiqlkvsvvaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03I (I:)
    mkvilleplenlgdvgqvvdvkpgyarnyllprglavlatesnlkaleariraqakrlae
    rkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrlalekpi
    kelgeyvltykphpevpiqlkvsvva
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2j03N (N:)
    mktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadki
    rvtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrl
    kvyagpdhphqaqrpeklev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03N (N:)
    mktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadki
    rvtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrl
    kvyagpdhphqaqrpekle
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j03O (O:)
    miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
    vvvrtkkeikrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
    vl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2j03P (P:)
    mklsdlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlm
    rlpkrgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegea
    kplkvvahafsksaleklkaaggepvllea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03P (P:)
    dlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpk
    rgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplk
    vvahafsksaleklkaaggepvllea
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2j03Q (Q:)
    mlmprrmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrr
    ggkifirifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealri
    aghklpiktkivrrdaydeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03Q (Q:)
    rmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrrggkif
    irifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealriaghkl
    piktkivrrdaydeaq
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2j03R (R:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03R (R:)
    rhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlh
    arrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2j03S (S:)
    marltayerrkfrvrnrikrtgrlrlsvfrslkhiyaqiiddekgvtlvsasslalklkg
    nktevarqvgralaekalalgikqvafdrgpykyhgrvkalaegaregglef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03S (S:)
    kfrvrnrikrtgrlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgnktevarqvg
    ralaekalalgikqvafdrgpykyhgrvkalaegaregg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2j03T (T:)
    mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
    ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
    idqdraaeraakeeaqkaqepkasqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03T (T:)
    mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
    ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
    idqdraaeraakeeaqka
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2j03U (U:)
    mpraktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrl
    wivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03U (U:)
    praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw
    ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j03V (V:)
    mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
    vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j03W (W:)
    meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
    nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgekhgk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2j03X (X:)
    mktaydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvr
    gkkkrlgrylgkrpdrkkaivqvapgqkiealegli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03X (X:)
    taydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvrgk
    kkrlgrylgkrpdrkkaivqvapgqkiealegl
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2j03Y (Y:)
    mrvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggf
    iekeaplhaskvrpicpacgkptrvrkkflengkkirvcakcggaldtee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03Y (Y:)
    rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi
    ekeaplhaskvrpicpacgkptrvrkkflengkkirvcakc
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2j03Z (Z:)
    meyrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivle
    lpdgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqei
    hrdilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppedv
    eklaeeaaaevaepevikkgkeeeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03Z (Z:)
    yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp
    dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr
    dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvpped