Lineage for d2j03u1 (2j03 U:2-118)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734855Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2734896Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
    automatically mapped to Pfam PF00453
  5. 2734897Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 2734898Protein Ribosomal protein L20 [74733] (4 species)
  7. 2734938Species Thermus thermophilus [TaxId:274] [158510] (15 PDB entries)
    Uniprot P60491 1-117
  8. 2734939Domain d2j03u1: 2j03 U:2-118 [145604]
    Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    protein/RNA complex
    protein/RNA complex

Details for d2j03u1

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (U:) 50S ribosomal protein L20

SCOPe Domain Sequences for d2j03u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j03u1 a.144.2.1 (U:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]}
praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw
ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg

SCOPe Domain Coordinates for d2j03u1:

Click to download the PDB-style file with coordinates for d2j03u1.
(The format of our PDB-style files is described here.)

Timeline for d2j03u1: