SCOP 1.73: Domain d2j03i1: 2j03 I:56-146

Lineage for d2j03i1 (2j03 I:56-146)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
   alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta

4. Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family)

5. Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)

6. Protein Ribosomal protein L9 C-domain [55655] (2 species)

7. Species Thermus thermophilus [TaxId:274] [143635] (2 PDB entries)

8. Domain d2j03i1: 2j03 I:56-146 [137888]
   Other proteins in same PDB: d2j0321, d2j03c1, d2j03i2, d2j03o1
   automatically matched to 2J01 I:56-146
   complexed with lys

Details for d2j03i1

PDB Entry: 2j03, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.

PDB Compounds: (I:) 50S ribosomal protein L9

SCOP Domain Sequences for d2j03i1:

Sequence, based on SEQRES records:

>d2j03i1 d.99.1.1 (I:56-146) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
krlaerkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla
lekpikelgeyvltykphpevpiqlkvsvva

Sequence, based on observed residues (ATOM records):

>d2j03i1 d.99.1.1 (I:56-146) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
krlaerkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla
lekpikelgeyvltykphpevpiqlkvsvvv

Timeline for d2j03i1:

• d2j03i1 is new in SCOP 1.73
  
• d2j03i1 appears in SCOP 1.75
  
• d2j03i1 appears in the current release, SCOPe 2.08