SCOPe 2.08: Domain d2izye2: 2izy E:5-47

Lineage for d2izye2 (2izy E:5-47)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)

6. Protein automated matches [190321] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187154] (1 PDB entry)

8. Domain d2izye2: 2izy E:5-47 [137834]
   Other proteins in same PDB: d2izya3, d2izyb3, d2izyc3, d2izyd3, d2izye3, d2izyf3, d2izyg3, d2izyh3
   automated match to d1l6ea_

Details for d2izye2

PDB Entry: 2izy, 2.2 Å

PDB Description: molecular basis of akap specificity for pka regulatory subunits

PDB Compounds: (E:) camp-dependent protein kinase regulatory subunit II

SCOPe Domain Sequences for d2izye2:

Sequence; same for both SEQRES and ATOM records:

>d2izye2 a.31.1.1 (E:5-47) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqippgltellqgytvevlrqqppdlvdfaveyftrlrearrg

Timeline for d2izye2:

• d2izye2 first appeared in SCOP 1.73, called d2izye1
  
• d2izye2 appears in SCOPe 2.07