![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily) 4 helices; bundle, closed, right-handed twist |
![]() | Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family) ![]() dimer of identical alpha-hairpin motifs |
![]() | Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (2 proteins) |
![]() | Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47394] (6 PDB entries) |
![]() | Domain d2izye1: 2izy E:6-46 [137834] automatically matched to d1l6ea_ |
PDB Entry: 2izy (more details), 2.2 Å
SCOP Domain Sequences for d2izye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2izye1 a.31.1.1 (E:6-46) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]} qippgltellqgytvevlrqqppdlvdfaveyftrlrearr
Timeline for d2izye1: