| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily) 4 helices; bundle, closed, right-handed twist |
Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) ![]() dimer of identical alpha-hairpin motifs |
| Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins) |
| Protein automated matches [190321] (3 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [187154] (1 PDB entry) |
| Domain d2izyd2: 2izy D:5-47 [137833] Other proteins in same PDB: d2izya3, d2izyb3, d2izyc3, d2izyd3, d2izye3, d2izyf3, d2izyg3, d2izyh3 automated match to d1l6ea_ |
PDB Entry: 2izy (more details), 2.2 Å
SCOPe Domain Sequences for d2izyd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2izyd2 a.31.1.1 (D:5-47) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqippgltellqgytvevlrqqppdlvdfaveyftrlrearrg
Timeline for d2izyd2: