Lineage for d2izyc2 (2izy C:6-47)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709186Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 2709187Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) (S)
    dimer of identical alpha-hairpin motifs
  5. 2709188Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)
  6. 2709206Protein automated matches [190321] (3 species)
    not a true protein
  7. 2709224Species Mouse (Mus musculus) [TaxId:10090] [187154] (1 PDB entry)
  8. 2709227Domain d2izyc2: 2izy C:6-47 [137832]
    Other proteins in same PDB: d2izya3, d2izyb3, d2izyc3, d2izyd3, d2izye3, d2izyf3, d2izyg3, d2izyh3
    automated match to d1l6ea_

Details for d2izyc2

PDB Entry: 2izy (more details), 2.2 Å

PDB Description: molecular basis of akap specificity for pka regulatory subunits
PDB Compounds: (C:) camp-dependent protein kinase regulatory subunit II

SCOPe Domain Sequences for d2izyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izyc2 a.31.1.1 (C:6-47) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qippgltellqgytvevlrqqppdlvdfaveyftrlrearrg

SCOPe Domain Coordinates for d2izyc2:

Click to download the PDB-style file with coordinates for d2izyc2.
(The format of our PDB-style files is described here.)

Timeline for d2izyc2: