SCOPe 2.08: Domain d2iszc1: 2isz C:1-64

Lineage for d2iszc1 (2isz C:1-64)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
   automatically mapped to Pfam PF01325

6. Protein Iron-dependent regulator IdeR [46885] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries)
   Uniprot Q50495

8. Domain d2iszc1: 2isz C:1-64 [137620]
   Other proteins in same PDB: d2isza2, d2iszb2, d2iszc2, d2iszd2
   automated match to d1fx7a1
   protein/DNA complex; complexed with na, ni

Details for d2iszc1

PDB Entry: 2isz, 2.4 Å

PDB Description: crystal structure of a two-domain ider-dna complex crystal form i

PDB Compounds: (C:) iron-dependent repressor ider

SCOPe Domain Sequences for d2iszc1:

Sequence; same for both SEQRES and ATOM records:

>d2iszc1 a.4.5.24 (C:1-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]}
mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
hlel

Timeline for d2iszc1:

• d2iszc1 first appeared in SCOP 1.73
  
• d2iszc1 appears in SCOPe 2.07