![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
![]() | Protein Iron-dependent regulator IdeR [46885] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries) Uniprot Q50495 |
![]() | Domain d2iszc1: 2isz C:1-64 [137620] Other proteins in same PDB: d2isza2, d2iszb2, d2iszc2, d2iszd2 automated match to d1fx7a1 protein/DNA complex; complexed with na, ni |
PDB Entry: 2isz (more details), 2.4 Å
SCOPe Domain Sequences for d2iszc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iszc1 a.4.5.24 (C:1-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr hlel
Timeline for d2iszc1: