Lineage for d1fx7a1 (1fx7 A:1-64)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693576Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. 2693612Protein Iron-dependent regulator IdeR [46885] (1 species)
  7. 2693613Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries)
    Uniprot Q50495
  8. 2693616Domain d1fx7a1: 1fx7 A:1-64 [60088]
    Other proteins in same PDB: d1fx7a2, d1fx7a3, d1fx7b2, d1fx7b3, d1fx7c2, d1fx7c3, d1fx7d2, d1fx7d3
    complexed with co, so4

Details for d1fx7a1

PDB Entry: 1fx7 (more details), 2 Å

PDB Description: crystal structure of the iron-dependent regulator (ider) from mycobacterium tuberculosis
PDB Compounds: (A:) iron-dependent repressor ider

SCOPe Domain Sequences for d1fx7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx7a1 a.4.5.24 (A:1-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]}
mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
hlel

SCOPe Domain Coordinates for d1fx7a1:

Click to download the PDB-style file with coordinates for d1fx7a1.
(The format of our PDB-style files is described here.)

Timeline for d1fx7a1: