Lineage for d2iamb1 (2iam B:93-190)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747484Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2747492Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 2747525Domain d2iamb1: 2iam B:93-190 [137160]
    Other proteins in same PDB: d2iama1, d2iama2, d2iamb2, d2iamc1, d2iamc2, d2iamd1, d2iamd2
    automated match to d1klub1
    mutant

Details for d2iamb1

PDB Entry: 2iam (more details), 2.8 Å

PDB Description: structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2iamb1:

Sequence, based on SEQRES records: (download)

>d2iamb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d2iamb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqtlvm
letvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d2iamb1:

Click to download the PDB-style file with coordinates for d2iamb1.
(The format of our PDB-style files is described here.)

Timeline for d2iamb1: