SCOPe 2.08: Domain d2iama1: 2iam A:82-181

Lineage for d2iama1 (2iam A:82-181)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
   Uniprot P01903 28-207
   probably orthologous to the mouse I-E group

8. Domain d2iama1: 2iam A:82-181 [137158]
   Other proteins in same PDB: d2iama2, d2iamb1, d2iamb2, d2iamc1, d2iamc2, d2iamd1, d2iamd2
   automated match to d1jwua1
   mutant

Details for d2iama1

PDB Entry: 2iam, 2.8 Å

PDB Description: structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2iama1:

Sequence; same for both SEQRES and ATOM records:

>d2iama1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d2iama1:

• d2iama1 first appeared in SCOP 1.73
  
• d2iama1 appears in SCOPe 2.07