SCOPe 2.08: Domain d2iama2: 2iam A:3-81

Lineage for d2iama2 (2iam A:3-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries)

8. Domain d2iama2: 2iam A:3-81 [137159]
   Other proteins in same PDB: d2iama1, d2iamb1, d2iamb2, d2iamc1, d2iamc2, d2iamd1, d2iamd2
   automated match to d1jwua2
   mutant
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2iama2

PDB Entry: 2iam, 2.8 Å

PDB Description: structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2iama2:

Sequence; same for both SEQRES and ATOM records:

>d2iama2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

Timeline for d2iama2:

• d2iama2 first appeared in SCOP 1.73
  
• d2iama2 appears in SCOPe 2.07