SCOPe 2.08: Domain d2iamb2: 2iam B:1-92

Lineage for d2iamb2 (2iam B:1-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries)

8. Domain d2iamb2: 2iam B:1-92 [137161]
   Other proteins in same PDB: d2iama1, d2iama2, d2iamb1, d2iamc1, d2iamc2, d2iamd1, d2iamd2
   automated match to d1klub2
   mutant
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2iamb2

PDB Entry: 2iam, 2.8 Å

PDB Description: structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2iamb2:

Sequence; same for both SEQRES and ATOM records:

>d2iamb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

Timeline for d2iamb2:

• d2iamb2 first appeared in SCOP 1.73
  
• d2iamb2 appears in SCOPe 2.07