SCOPe 2.08: Domain d2i3ha1: 2i3h A:78-167

Lineage for d2i3ha1 (2i3h A:78-167)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103631] (8 PDB entries)
   Uniprot Q96CA5 78-159

8. Domain d2i3ha1: 2i3h A:78-167 [137023]
   automatically matched to d1tw6b_
   complexed with btb, edo, li, zn

Details for d2i3ha1

PDB Entry: 2i3h, 1.62 Å

PDB Description: structure of an ml-iap/xiap chimera bound to a 4-mer peptide (avpw)

PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 7

SCOPe Domain Sequences for d2i3ha1:

Sequence; same for both SEQRES and ATOM records:

>d2i3ha1 g.52.1.1 (A:78-167) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpgcqfllrskgqeyinnih

Timeline for d2i3ha1:

• d2i3ha1 first appeared in SCOP 1.73
  
• d2i3ha1 appears in SCOPe 2.07