| Class g: Small proteins [56992] (100 folds) |
| Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
| Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
| Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [103631] (8 PDB entries) Uniprot Q96CA5 78-159 |
| Domain d2i3hb1: 2i3h B:78-167 [137024] automatically matched to d1tw6b_ complexed with btb, edo, li, zn |
PDB Entry: 2i3h (more details), 1.62 Å
SCOPe Domain Sequences for d2i3hb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i3hb1 g.52.1.1 (B:78-167) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpgcqfllrskgqeyinnih
Timeline for d2i3hb1: