Lineage for d1tw6b_ (1tw6 B:)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
metal(zinc)-bound alpha+beta foldSuperfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) 
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) 
Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species) Species Human (Homo sapiens) [TaxId:9606] [103631] (8 PDB entries)
Uniprot Q96CA5 78-159
Domain d1tw6b_: 1tw6 B: [112695]
BIR2; alternative splicing
complexed with btb, edo, li, zn
Details for d1tw6b_
PDB Entry: 1tw6 (more details), 1.71 Å
PDB Description: structure of an ml-iap/xiap chimera bound to a 9mer peptide derived from smac
PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 7SCOPe Domain Sequences for d1tw6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tw6b_ g.52.1.1 (B:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpgcqfllrskgqeyinnihlthsl
SCOPe Domain Coordinates for d1tw6b_:
Click to download the PDB-style file with coordinates for d1tw6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tw6b_:
- d1tw6b_ first appeared in SCOP 1.71
- d1tw6b_ appears in SCOPe 2.07
View in 3D
