SCOPe 2.08: Domain d1tw6a_: 1tw6 A:

Lineage for d1tw6a_ (1tw6 A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103631] (8 PDB entries)
   Uniprot Q96CA5 78-159

8. Domain d1tw6a_: 1tw6 A: [112694]
   BIR2; alternative splicing
   complexed with btb, edo, li, zn

Details for d1tw6a_

PDB Entry: 1tw6, 1.71 Å

PDB Description: structure of an ml-iap/xiap chimera bound to a 9mer peptide derived from smac

PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 7

SCOPe Domain Sequences for d1tw6a_:

Sequence; same for both SEQRES and ATOM records:

>d1tw6a_ g.52.1.1 (A:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpgcqfllrskgqeyinnih

Timeline for d1tw6a_:

• d1tw6a_ first appeared in SCOP 1.71
  
• d1tw6a_ appears in SCOPe 2.07