SCOP 1.71: Domain d1tw6b_: 1tw6 B:

Lineage for d1tw6b_ (1tw6 B:)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (6 proteins)

6. Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103631] (4 PDB entries)

8. Domain d1tw6b_: 1tw6 B: [112695]
   BIR2; alternative splicing
   complexed with btb, edo, li, zn; mutant

Details for d1tw6b_

PDB Entry: 1tw6, 1.71 Å

PDB Description: structure of an ml-iap/xiap chimera bound to a 9mer peptide derived from smac

SCOP Domain Sequences for d1tw6b_:

Sequence; same for both SEQRES and ATOM records:

>d1tw6b_ g.52.1.1 (B:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens)}
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpgcqfllrskgqeyinnihlthsl

Timeline for d1tw6b_:

• d1tw6b_ is new in SCOP 1.71
  
• d1tw6b_ appears in SCOP 1.73
  
• d1tw6b_ appears in the current release, SCOPe 2.08