PDB entry 1tw6

View 1tw6 on RCSB PDB site
Description: Structure of an ML-IAP/XIAP chimera bound to a 9mer peptide derived from Smac
Class: inhibitor/apoptosis
Keywords: zinc binding, peptide complex, apoptosis inhibition, inhibitor-apoptosis complex
Deposited on 2004-06-30, released 2004-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.156
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96CA5
      • see remark 999 (110)
      • see remark 999 (121-127)
    Domains in SCOPe 2.08: d1tw6a_
  • Chain 'B':
    Compound: Baculoviral IAP repeat-containing protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96CA5 (Start-131)
      • see remark 999 (110)
      • see remark 999 (121-128)
      • see remark 999 (132)
    Domains in SCOPe 2.08: d1tw6b_
  • Chain 'C':
    Compound: Diablo homolog, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: DIABLO, SMAC
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Diablo homolog, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: DIABLO, SMAC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, LI, BTB, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tw6A (A:)
    mgsshhhhhhssglvprgshmleteeeeeegagatlsrgpafpgmgseelrlasfydwpl
    taevppellaaagffhtghqdkvrcffcygglqswkrgddpwtehakwfpgcqfllrskg
    qeyinnihlthsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw6A (A:)
    gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
    ddpwtehakwfpgcqfllrskgqeyinnih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tw6B (B:)
    mgsshhhhhhssglvprgshmleteeeeeegagatlsrgpafpgmgseelrlasfydwpl
    taevppellaaagffhtghqdkvrcffcygglqswkrgddpwtehakwfpgcqfllrskg
    qeyinnihlthsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw6B (B:)
    gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
    ddpwtehakwfpgcqfllrskgqeyinnihlthsl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.