Lineage for d2hv7h_ (2hv7 H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738810Fold a.268: PTPA-like [140983] (1 superfamily)
    multihelical
  4. 2738811Superfamily a.268.1: PTPA-like [140984] (1 family) (S)
    automatically mapped to Pfam PF03095
  5. 2738812Family a.268.1.1: PTPA-like [140985] (2 proteins)
    Pfam PF03095
  6. 2738813Protein Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA [140986] (2 species)
  7. 2738818Species Human (Homo sapiens) [TaxId:9606] [140987] (4 PDB entries)
    Uniprot Q15257 22-322! Uniprot Q15257 23-322
  8. 2738830Domain d2hv7h_: 2hv7 H: [136793]
    automated match to d2hv6a1
    complexed with adp

Details for d2hv7h_

PDB Entry: 2hv7 (more details), 2.5 Å

PDB Description: Crystal structure of phosphotyrosyl phosphatase activator bound to ATPgammaS
PDB Compounds: (H:) Protein phosphatase 2A, regulatory subunit B

SCOPe Domain Sequences for d2hv7h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hv7h_ a.268.1.1 (H:) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Human (Homo sapiens) [TaxId: 9606]}
nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
s

SCOPe Domain Coordinates for d2hv7h_:

Click to download the PDB-style file with coordinates for d2hv7h_.
(The format of our PDB-style files is described here.)

Timeline for d2hv7h_: