PDB entry 2hv7

View 2hv7 on RCSB PDB site
Description: Crystal structure of phosphotyrosyl phosphatase activator bound to ATPgammaS
Class: Unknown Function
Keywords: phosphotyrosyl phosphatase activator, PP2A, phosphatase, phosphatase specificity, Unknown Function
Deposited on 2006-07-27, released 2006-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.252
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein phosphatase 2A, regulatory subunit B
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP2R4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hv7a_
  • Chain 'B':
    Compound: Protein phosphatase 2A, regulatory subunit B
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP2R4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hv7b_
  • Chain 'C':
    Compound: Protein phosphatase 2A, regulatory subunit B
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP2R4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hv7c_
  • Chain 'D':
    Compound: Protein phosphatase 2A, regulatory subunit B
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP2R4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hv7d_
  • Chain 'E':
    Compound: Protein phosphatase 2A, regulatory subunit B
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP2R4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hv7e_
  • Chain 'F':
    Compound: Protein phosphatase 2A, regulatory subunit B
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP2R4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hv7f_
  • Chain 'G':
    Compound: Protein phosphatase 2A, regulatory subunit B
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP2R4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hv7g_
  • Chain 'H':
    Compound: Protein phosphatase 2A, regulatory subunit B
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP2R4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hv7h_
  • Heterogens: ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hv7A (A:)
    maegerqpppdsseeappatqnfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvk
    gkkltfeyrvseaieklvallntldrwidetppvdqpsrfgnkayrtwyakldeeaenlv
    atvvpthlaaavpevavylkesvgnstridygtgheaafaaflcclckigvlrvddqiai
    vfkvfnrylevmrklqktyrmepagsqgvwglddfqflpfiwgssqlidhpyleprhfvd
    ekavnenhkdymflecilfitemktgpfaehsnqlwnisavpswskvnqglirmykaecl
    ekfpviqhfkfgsllpihpvtsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv7A (A:)
    nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
    ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
    svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
    epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
    emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hv7B (B:)
    maegerqpppdsseeappatqnfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvk
    gkkltfeyrvseaieklvallntldrwidetppvdqpsrfgnkayrtwyakldeeaenlv
    atvvpthlaaavpevavylkesvgnstridygtgheaafaaflcclckigvlrvddqiai
    vfkvfnrylevmrklqktyrmepagsqgvwglddfqflpfiwgssqlidhpyleprhfvd
    ekavnenhkdymflecilfitemktgpfaehsnqlwnisavpswskvnqglirmykaecl
    ekfpviqhfkfgsllpihpvtsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv7B (B:)
    nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
    ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
    svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
    epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
    emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
    s
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hv7C (C:)
    maegerqpppdsseeappatqnfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvk
    gkkltfeyrvseaieklvallntldrwidetppvdqpsrfgnkayrtwyakldeeaenlv
    atvvpthlaaavpevavylkesvgnstridygtgheaafaaflcclckigvlrvddqiai
    vfkvfnrylevmrklqktyrmepagsqgvwglddfqflpfiwgssqlidhpyleprhfvd
    ekavnenhkdymflecilfitemktgpfaehsnqlwnisavpswskvnqglirmykaecl
    ekfpviqhfkfgsllpihpvtsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv7C (C:)
    nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
    ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
    svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
    epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
    emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
    s
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hv7D (D:)
    maegerqpppdsseeappatqnfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvk
    gkkltfeyrvseaieklvallntldrwidetppvdqpsrfgnkayrtwyakldeeaenlv
    atvvpthlaaavpevavylkesvgnstridygtgheaafaaflcclckigvlrvddqiai
    vfkvfnrylevmrklqktyrmepagsqgvwglddfqflpfiwgssqlidhpyleprhfvd
    ekavnenhkdymflecilfitemktgpfaehsnqlwnisavpswskvnqglirmykaecl
    ekfpviqhfkfgsllpihpvtsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv7D (D:)
    nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
    ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
    svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
    epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
    emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
    s
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2hv7E (E:)
    maegerqpppdsseeappatqnfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvk
    gkkltfeyrvseaieklvallntldrwidetppvdqpsrfgnkayrtwyakldeeaenlv
    atvvpthlaaavpevavylkesvgnstridygtgheaafaaflcclckigvlrvddqiai
    vfkvfnrylevmrklqktyrmepagsqgvwglddfqflpfiwgssqlidhpyleprhfvd
    ekavnenhkdymflecilfitemktgpfaehsnqlwnisavpswskvnqglirmykaecl
    ekfpviqhfkfgsllpihpvtsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv7E (E:)
    nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
    ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
    svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
    epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
    emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
    s
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2hv7F (F:)
    maegerqpppdsseeappatqnfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvk
    gkkltfeyrvseaieklvallntldrwidetppvdqpsrfgnkayrtwyakldeeaenlv
    atvvpthlaaavpevavylkesvgnstridygtgheaafaaflcclckigvlrvddqiai
    vfkvfnrylevmrklqktyrmepagsqgvwglddfqflpfiwgssqlidhpyleprhfvd
    ekavnenhkdymflecilfitemktgpfaehsnqlwnisavpswskvnqglirmykaecl
    ekfpviqhfkfgsllpihpvtsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv7F (F:)
    nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
    ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
    svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
    epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
    emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
    s
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2hv7G (G:)
    maegerqpppdsseeappatqnfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvk
    gkkltfeyrvseaieklvallntldrwidetppvdqpsrfgnkayrtwyakldeeaenlv
    atvvpthlaaavpevavylkesvgnstridygtgheaafaaflcclckigvlrvddqiai
    vfkvfnrylevmrklqktyrmepagsqgvwglddfqflpfiwgssqlidhpyleprhfvd
    ekavnenhkdymflecilfitemktgpfaehsnqlwnisavpswskvnqglirmykaecl
    ekfpviqhfkfgsllpihpvtsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv7G (G:)
    nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
    ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
    svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
    epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
    emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
    s
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2hv7H (H:)
    maegerqpppdsseeappatqnfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvk
    gkkltfeyrvseaieklvallntldrwidetppvdqpsrfgnkayrtwyakldeeaenlv
    atvvpthlaaavpevavylkesvgnstridygtgheaafaaflcclckigvlrvddqiai
    vfkvfnrylevmrklqktyrmepagsqgvwglddfqflpfiwgssqlidhpyleprhfvd
    ekavnenhkdymflecilfitemktgpfaehsnqlwnisavpswskvnqglirmykaecl
    ekfpviqhfkfgsllpihpvtsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv7H (H:)
    nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
    ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
    svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
    epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
    emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
    s